PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 215aa    MW: 24489 Da    PI: 4.4874
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22922genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.93.6e-183078251
       NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
               pG+rFhPtdeelv +yL++k+++k+l++ evi+e+diyk++PwdLp+ v
  EMT22922 30 LPGYRFHPTDEELVAFYLRRKMARKSLRI-EVIREMDIYKHDPWDLPRGV 78
              69***************************.99**************9633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-182877IPR003441NAC domain
PROSITE profilePS5100514.28529188IPR003441NAC domain
PfamPF023656.2E-931152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MELEMEKATR DGELVLGGAG DEEEEEDVVL PGYRFHPTDE ELVAFYLRRK MARKSLRIEV  60
IREMDIYKHD PWDLPRGVDH LQDLQEGHHL PEPAAAVEAG ARAVLRRFEL QQGGLPGHQQ  120
QYVSRTGTVD SGNFFYEDNM HNQQFQGQWN AAPAAPVPEQ KQQNPLSTAV DFHQNDNSHA  180
VAANDFYKVE GYLEEIARML EVADPAGFYD YRSYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-122275861Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3747288e-86AK374728.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3074N05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466362.14e-30hypothetical protein SORBIDRAFT_01g006410
TrEMBLM8C7C41e-159M8C7C4_AEGTA; Putative NAC domain-containing protein 9
STRINGMLOC_4952.13e-37(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-19NAC domain containing protein 42